PDB entry 1woc

View 1woc on RCSB PDB site
Description: Crystal structure of PriB
Class: DNA binding protein
Keywords: Oligonucleotide Binding fold, DNA BINDING PROTEIN
Deposited on 2004-08-13, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: primosomal replication protein n
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1woca_
  • Chain 'B':
    Compound: primosomal replication protein n
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wocb_
  • Chain 'C':
    Compound: primosomal replication protein n
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wocc_
  • Chain 'D':
    Compound: primosomal replication protein n
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wocd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wocA (A:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wocA (A:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqieli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wocB (B:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wocB (B:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqieli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wocC (C:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wocC (C:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqielid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wocD (D:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqielidsgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wocD (D:)
    tnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsghenqa
    ithsitvgsritvqgfischkaknglskmvlhaeqieli