PDB entry 1wny

View 1wny on RCSB PDB site
Description: Isoleucyl-tRNA synthetase editing domain
Class: Ligase
Keywords: Ligase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-08-11, released 2005-10-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690
      • conflict (74)
    Domains in SCOPe 2.06: d1wnya_
  • Chain 'B':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690
      • conflict (74)
    Domains in SCOPe 2.06: d1wnyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnyA (A:)
    mqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdeali
    leeglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivh
    qapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfke
    esylhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnyA (A:)
    dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
    eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
    pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnyB (B:)
    mqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdeali
    leeglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivh
    qapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfke
    esylhs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnyB (B:)
    dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
    eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
    pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees