PDB entry 1wnx

View 1wnx on RCSB PDB site
Description: D136E mutant of Heme Oxygenase from Corynebacterium diphtheriae (HmuO)
Class: oxidoreductase
Keywords: Heme, alpha-helix, OXIDOREDUCTASE
Deposited on 2004-08-10, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.155
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • engineered (135)
      • see remark 999 (191)
    Domains in SCOPe 2.06: d1wnxa_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • engineered (135)
      • see remark 999 (191)
    Domains in SCOPe 2.06: d1wnxb_
  • Heterogens: SO4, NA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnxA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgelsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnxA (A:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgelsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnxB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgelsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnxB (B:)
    tataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavda
    vrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdg
    palvahhyvrylgelsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnn
    lelsdeqrehllkeatdafvfnhqvfadlg