PDB entry 1wnw

View 1wnw on RCSB PDB site
Description: D136N mutant of Heme Oxygenase from Corynebacterium diphtheriae (HmuO)
Class: oxidoreductase
Keywords: Heme, alpha-helix
Deposited on 2004-08-10, released 2004-11-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-08, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • engineered (135)
      • see remark 999 (191)
    Domains in SCOP 1.73: d1wnwa_
  • Chain 'B':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119 (Start-214)
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • engineered (135)
      • see remark 999 (191)
    Domains in SCOP 1.73: d1wnwb_
  • Chain 'C':
    Compound: Heme oxygenase
    Species: Corynebacterium diphtheriae
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71119
      • see remark 999 (33)
      • see remark 999 (59)
      • see remark 999 (91-92)
      • engineered (135)
      • see remark 999 (191)
    Domains in SCOP 1.73: d1wnwc_
  • Heterogens: IOD, NA, SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnwA (A:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnwA (A:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnwB (B:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnwB (B:)
    aglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavra
    sgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpal
    vahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlel
    sdeqrehllkeatdafvfnhqvfadlgkgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wnwC (C:)
    mttataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqav
    davrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnv
    dgpalvahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyrekl
    nnlelsdeqrehllkeatdafvfnhqvfadlgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnwC (C:)
    glavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavdavras
    gfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdgpalv
    ahhyvrylgnlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnnlels
    deqrehllkeatdafvfnhqvfadlg