PDB entry 1wnt

View 1wnt on RCSB PDB site
Description: Strucutre of the tetrameric form of Human L-Xylulose Reductase
Class: Oxidoreductase
Keywords: 7 stranded parallel beta sheets, 6 alpha helices, Rossmann fold, dinucleotide co-enzyme binding motif, Oxidoreductase
Deposited on 2004-08-09, released 2005-07-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.32
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wnta_
  • Chain 'B':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wntb_
  • Chain 'C':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wntc_
  • Chain 'D':
    Compound: L-xylulose reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wntd_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wntA (A:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wntB (B:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wntC (C:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wntD (D:)
    melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
    lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
    gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
    vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
    fwac