PDB entry 1wns

View 1wns on RCSB PDB site
Description: crystal structure of family b dna polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis kod1
Deposited on 2004-08-09, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.231
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnsA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgsgrigdraipfdef
    dptkhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglsawlkpkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnsA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyienqvlpaverilrg
    yrkedlryq