PDB entry 1wns

View 1wns on RCSB PDB site
Description: Crystal structure of family B DNA polymerase from hyperthermophilic archaeon pyrococcus kodakaraensis KOD1
Class: transferase
Keywords: transferase
Deposited on 2004-08-09, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnsa1, d1wnsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnsA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgsgrigdraipfdef
    dptkhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglsawlkpkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnsA (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyhegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfykrgffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyienqvlpaverilrg
    yrkedlryq