PDB entry 1wnq

View 1wnq on RCSB PDB site
Description: Crystal Structure Of SARS-CoV Mpro in Complex with an Inhibitor I2
Class: hydrolase
Keywords: Anti-parallel B-barrel, anti-parallel A-helices
Deposited on 2004-08-08, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-09-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.209
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3C-like proteinase
    Species: SARS CORONAVIRUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnqa_
  • Chain 'B':
    Compound: 3C-like proteinase
    Species: SARS CORONAVIRUS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnqb_
  • Heterogens: ENB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnqA (A:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnqA (A:)
    frkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirks
    nhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngsp
    sgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkfy
    gpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyepl
    tqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcsg
    v
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnqB (B:)
    gplgssgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnye
    dllirksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvl
    acyngspsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagt
    dlegkfygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvam
    kynyepltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfd
    vvrqcsgvtfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnqB (B:)
    sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
    ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
    spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
    fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
    pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
    sg