PDB entry 1wnl

View 1wnl on RCSB PDB site
Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with ADP
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-08-05, released 2005-08-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii OT3
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wnla1, d1wnla2
  • Chain 'B':
    Compound: biotin--[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii OT3
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wnlb1, d1wnlb2
  • Heterogens: ADP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wnlA (A:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wnlB (B:)
    mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
    wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
    gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
    lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl