PDB entry 1wnj

View 1wnj on RCSB PDB site
Description: nmr structure of human coactosin-like protein
Deposited on 2004-08-05, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1wnja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wnjA (A:)
girmatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvr
lfafvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdr
keleedfikselkkagganydaqte