PDB entry 1wnj

View 1wnj on RCSB PDB site
Description: NMR structure of human coactosin-like protein
Class: protein binding
Keywords: beta-alpha, PROTEIN BINDING
Deposited on 2004-08-05, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14019 (3-144)
      • cloning artifact (0-2)
    Domains in SCOPe 2.08: d1wnja1, d1wnja2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wnjA (A:)
    girmatkidkeacraaynlvrddgsaviwvtfkydgstivpgeqgaeyqhfiqqctddvr
    lfafvrfttgdamskrskfalitwigenvsglqraktgtdktlvkevvqnfakefvisdr
    keleedfikselkkagganydaqte