PDB entry 1wni

View 1wni on RCSB PDB site
Description: crystal structure of h2-proteinase
Deposited on 2004-08-04, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1wnia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wniA (A:)
    qrfpqryielaivvdhgmykkynqnsdkikvrvhqmvnhinemyrplniaislnrlqiws
    kkdlitvksasnvtlesfgnwretvllkqqnndcahlltatnlndntiglaykkgmcnpk
    lsvglvqdyspnvfmvavtmthelghnlgmehddkdkckceacimsdvisdkpsklfsdc
    skndyqtfltkynpqcilnap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wniA (A:)
    fpqryielaivvdhgmykkynqnsdkikvrvhqmvnhinemyrplniaislnrlqiwskk
    dlitvksasnvtlesfgnwretvllkqqnndcahlltatnlndntiglaykkgmcnpkls
    vglvqdyspnvfmvavtmthelghnlgmehddkdkckceacimsdvisdkpsklfsdcsk
    ndyqtfltkynpqcilna