PDB entry 1wni

View 1wni on RCSB PDB site
Description: Crystal Structure of H2-Proteinase
Class: hydrolase
Keywords: metalloprotease, zinc, metzincin, snake venom, hydrolase
Deposited on 2004-08-04, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trimerelysin II
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnia_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wniA (A:)
    qrfpqryielaivvdhgmykkynqnsdkikvrvhqmvnhinemyrplniaislnrlqiws
    kkdlitvksasnvtlesfgnwretvllkqqnndcahlltatnlndntiglaykkgmcnpk
    lsvglvqdyspnvfmvavtmthelghnlgmehddkdkckceacimsdvisdkpsklfsdc
    skndyqtfltkynpqcilnap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wniA (A:)
    fpqryielaivvdhgmykkynqnsdkikvrvhqmvnhinemyrplniaislnrlqiwskk
    dlitvksasnvtlesfgnwretvllkqqnndcahlltatnlndntiglaykkgmcnpkls
    vglvqdyspnvfmvavtmthelghnlgmehddkdkckceacimsdvisdkpsklfsdcsk
    ndyqtfltkynpqcilna