PDB entry 1wng

View 1wng on RCSB PDB site
Description: Structural study of project ID PH0725 from Pyrococcus horikoshii OT3
Class: transferase
Keywords: Transferase, Methyltransferase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-08-02, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable diphthine synthase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnga_
  • Chain 'B':
    Compound: Probable diphthine synthase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wngb_
  • Heterogens: SO4, SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wngA (A:)
    mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
    edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
    gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
    amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
    klhiveaeylveiagapreilrvnv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wngB (B:)
    mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
    edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
    gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
    amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
    klhiveaeylveiagapreilrvnv