PDB entry 1wnf

View 1wnf on RCSB PDB site
Description: Crystal Structure of PH0066 from Pyrococcus horikoshii
Class: hydrolase
Keywords: alpha and beta proteins, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2004-08-02, released 2005-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.199
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-asparaginase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0066
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnfa_
  • Chain 'B':
    Compound: L-asparaginase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH0066
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnfb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnfA (A:)
    mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
    erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
    pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
    ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
    gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
    wilghtknieevkqlmgknitgeltrvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnfA (A:)
    mrililgmggtiasvkgergyesalsvskilklagisakieardlmnvdstliqpsdwer
    lakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsdapf
    nlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklril
    hipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyrgt
    dlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklmwi
    lghtknieevkqlmgknitgeltr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnfB (B:)
    mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
    erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
    pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
    ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
    gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
    wilghtknieevkqlmgknitgeltrvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnfB (B:)
    mrililgmggtiasvkgergyesalsvskilklagisakieardlmnvdstliqpsdwer
    lakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsdapf
    nlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklril
    hipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyrgt
    dlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklmwi
    lghtknieevkqlmgknitgeltr