PDB entry 1wne

View 1wne on RCSB PDB site
Description: Foot and Mouth Disease Virus RNA-dependent RNA polymerase in complex with a template-primer RNA
Class: transferase/RNA
Keywords: PROTEIN-DNA COMPLEX, Foot and Mouth Disease Virus, RNA-dependent RNA polymerase, TRANSFERASE-RNA COMPLEX
Deposited on 2004-07-31, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.273
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Foot-and-mouth disease virus [TaxId:244367]
    Gene: Viruses
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wnea1, d1wnea2
  • Chain 'B':
    Compound: 5'-r(*cp*ap*up*gp*gp*gp*cp*c)-3'
  • Chain 'C':
    Compound: 5'-r(*gp*gp*cp*cp*c)-3'
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wneA (A:)
    glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
    kgdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
    walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
    vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
    ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
    satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
    gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
    qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgdaaalehh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.