PDB entry 1wnc

View 1wnc on RCSB PDB site
Description: crystal structure of the sars-cov spike protein fusion core
Deposited on 2004-07-29, released 2004-09-07
The last revision prior to the SCOP 1.71 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.233
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1wnca_
  • Chain 'B':
    Domains in SCOP 1.71: d1wncb_
  • Chain 'C':
    Domains in SCOP 1.71: d1wncc_
  • Chain 'D':
    Domains in SCOP 1.71: d1wncd_
  • Chain 'E':
    Domains in SCOP 1.71: d1wnce_
  • Chain 'F':
    Domains in SCOP 1.71: d1wncf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wncA (A:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncA (A:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
    lnevaknln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wncB (B:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncB (B:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqisginasvvniqee
    idrlnevaknlneslidlqel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wncC (C:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncC (C:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
    lnevaknlneslidlqel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wncD (D:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncD (D:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqginasvvniqeei
    drlnevaknlneslidl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wncE (E:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncE (E:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlinasvvniqeei
    drlnevaknlnesl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wncF (F:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncF (F:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqnasvvniqeeidr
    lnevaknlneslidl