PDB entry 1wnc

View 1wnc on RCSB PDB site
Description: Crystal structure of the SARS-CoV Spike protein fusion core
Class: viral protein
Keywords: SARS-CoV, Spike protein, Fusion Core, Heptad repeat, Viral protein
Deposited on 2004-07-29, released 2004-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594
      • engineered (89)
    Domains in SCOPe 2.07: d1wnca_
  • Chain 'B':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594 (Start-111)
      • engineered (89)
    Domains in SCOPe 2.07: d1wncb_
  • Chain 'C':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594 (Start-111)
      • engineered (89)
    Domains in SCOPe 2.07: d1wncc_
  • Chain 'D':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594
      • engineered (89)
    Domains in SCOPe 2.07: d1wncd_
  • Chain 'E':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594
      • engineered (89)
    Domains in SCOPe 2.07: d1wnce_
  • Chain 'F':
    Compound: e2 glycoprotein
    Species: SARS coronavirus [TaxId:227859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59594
      • engineered (89)
    Domains in SCOPe 2.07: d1wncf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wncA (A:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncA (A:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
    lnevaknln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wncB (B:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncB (B:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqisginasvvniqee
    idrlnevaknlneslidlqel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wncC (C:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncC (C:)
    qkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqinasvvniqeeidr
    lnevaknlneslidlqel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wncD (D:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncD (D:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqginasvvniqeei
    drlnevaknlneslidl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wncE (E:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncE (E:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqlinasvvniqeei
    drlnevaknlnesl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wncF (F:)
    enqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqllvprgsggsgg
    sgglevlfqgpdvdlgdisginasvvniqeeidrlnevaknlneslidlqel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wncF (F:)
    nqkqianqfnkaisqiqesltttstalgklqdvvnqnaqalntlvkqnasvvniqeeidr
    lnevaknlneslidl