PDB entry 1wnb

View 1wnb on RCSB PDB site
Description: Escherichia coli YdcW gene product is a medium-chain aldehyde dehydrogenase (complexed with nadh and betaine aldehyde)
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, NADH, flurorescence, kinetics, OXIDOREDUCTASE
Deposited on 2004-07-29, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative betaine aldehyde dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77674 (21-494)
      • conflict (217)
    Domains in SCOPe 2.08: d1wnba_
  • Chain 'B':
    Compound: Putative betaine aldehyde dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77674 (21-494)
      • conflict (217)
    Domains in SCOPe 2.08: d1wnbb_
  • Chain 'C':
    Compound: Putative betaine aldehyde dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77674 (21-494)
      • conflict (217)
    Domains in SCOPe 2.08: d1wnbc_
  • Chain 'D':
    Compound: Putative betaine aldehyde dehydrogenase
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77674 (21-494)
      • conflict (217)
    Domains in SCOPe 2.08: d1wnbd_
  • Heterogens: NAI, BTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wnbA (A:)
    syyhhhhhhlestslykkaglmqhkllingelvsgegekqpvynpatgdvlleiaeasae
    qvdaavraadaafaewgqttpkvraecllkladvieengqvfaelesrncgkplhsafnd
    eipaivdvfrffagaarclnglaageyleghtsmirrdplgvvasiapwnyplmmaawkl
    apalaagncvvlkpseitpltalklaelakdifpagvvnilfgrgktvgdpltghpkvrm
    vsltgsiatgehiishtassikrthmelggkapvivfddadieavvegvrtfgyynagqd
    ctaacriyaqkgiydtlveklgaavatlksgapddestelgplsslahlervgkaveeak
    atghikvitggekrkgngyyyaptllagalqddaivqkevfgpvvsvtpfdneeqvvnwa
    ndsqyglassvwtkdvgrahrvsarlqygctwvnthfmlvsemphggqklsgygkdmsly
    gledytvvrhvmvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnbA (A:)
    mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
    kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
    laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
    alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
    krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
    gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
    aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
    vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wnbB (B:)
    syyhhhhhhlestslykkaglmqhkllingelvsgegekqpvynpatgdvlleiaeasae
    qvdaavraadaafaewgqttpkvraecllkladvieengqvfaelesrncgkplhsafnd
    eipaivdvfrffagaarclnglaageyleghtsmirrdplgvvasiapwnyplmmaawkl
    apalaagncvvlkpseitpltalklaelakdifpagvvnilfgrgktvgdpltghpkvrm
    vsltgsiatgehiishtassikrthmelggkapvivfddadieavvegvrtfgyynagqd
    ctaacriyaqkgiydtlveklgaavatlksgapddestelgplsslahlervgkaveeak
    atghikvitggekrkgngyyyaptllagalqddaivqkevfgpvvsvtpfdneeqvvnwa
    ndsqyglassvwtkdvgrahrvsarlqygctwvnthfmlvsemphggqklsgygkdmsly
    gledytvvrhvmvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnbB (B:)
    mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
    kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
    laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
    alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
    krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
    gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
    aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
    vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wnbC (C:)
    syyhhhhhhlestslykkaglmqhkllingelvsgegekqpvynpatgdvlleiaeasae
    qvdaavraadaafaewgqttpkvraecllkladvieengqvfaelesrncgkplhsafnd
    eipaivdvfrffagaarclnglaageyleghtsmirrdplgvvasiapwnyplmmaawkl
    apalaagncvvlkpseitpltalklaelakdifpagvvnilfgrgktvgdpltghpkvrm
    vsltgsiatgehiishtassikrthmelggkapvivfddadieavvegvrtfgyynagqd
    ctaacriyaqkgiydtlveklgaavatlksgapddestelgplsslahlervgkaveeak
    atghikvitggekrkgngyyyaptllagalqddaivqkevfgpvvsvtpfdneeqvvnwa
    ndsqyglassvwtkdvgrahrvsarlqygctwvnthfmlvsemphggqklsgygkdmsly
    gledytvvrhvmvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnbC (C:)
    mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
    kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
    laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
    alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
    krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
    gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
    aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
    vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wnbD (D:)
    syyhhhhhhlestslykkaglmqhkllingelvsgegekqpvynpatgdvlleiaeasae
    qvdaavraadaafaewgqttpkvraecllkladvieengqvfaelesrncgkplhsafnd
    eipaivdvfrffagaarclnglaageyleghtsmirrdplgvvasiapwnyplmmaawkl
    apalaagncvvlkpseitpltalklaelakdifpagvvnilfgrgktvgdpltghpkvrm
    vsltgsiatgehiishtassikrthmelggkapvivfddadieavvegvrtfgyynagqd
    ctaacriyaqkgiydtlveklgaavatlksgapddestelgplsslahlervgkaveeak
    atghikvitggekrkgngyyyaptllagalqddaivqkevfgpvvsvtpfdneeqvvnwa
    ndsqyglassvwtkdvgrahrvsarlqygctwvnthfmlvsemphggqklsgygkdmsly
    gledytvvrhvmvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wnbD (D:)
    mqhkllingelvsgegekqpvynpatgdvlleiaeasaeqvdaavraadaafaewgqttp
    kvraecllkladvieengqvfaelesrncgkplhsafndeipaivdvfrffagaarclng
    laageyleghtsmirrdplgvvasiapwnyplmmaawklapalaagncvvlkpseitplt
    alklaelakdifpagvvnilfgrgktvgdpltghpkvrmvsltgsiatgehiishtassi
    krthmelggkapvivfddadieavvegvrtfgyynagqdctaacriyaqkgiydtlvekl
    gaavatlksgapddestelgplsslahlervgkaveeakatghikvitggekrkgngyyy
    aptllagalqddaivqkevfgpvvsvtpfdneeqvvnwandsqyglassvwtkdvgrahr
    vsarlqygctwvnthfmlvsemphggqklsgygkdmslygledytvvrhvmvkh