SCOPe 2.07: Structural Classification of Proteins

PDB entry 1wn9

View 1wn9 on RCSB PDB site
Description: Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8
Class: structural genomics, unknown function
Keywords: Thermus thermophillus, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-07-28, released 2005-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.214
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: the hypothetical protein (TT1805)
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q5SI52 (0-End)
Domains in SCOPe 2.07: d1wn9a1
Heterogens: ACY, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1wn9A (A:)
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiylkraa

Sequence, based on observed residues (ATOM records): (download)

>1wn9A (A:)
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiyl