PDB entry 1wn9

View 1wn9 on RCSB PDB site
Description: Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8
Class: structural genomics, unknown function
Keywords: Thermus thermophillus, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2004-07-28, released 2005-01-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.214
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: the hypothetical protein (TT1805)
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wn9a1
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wn9A (A:)
    mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
    dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
    tdpgiylkraa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn9A (A:)
    mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
    dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
    tdpgiyl