PDB entry 1wn7

View 1wn7 on RCSB PDB site
Description: Crystal structure of archaeal family B DNA polymerase mutant
Class: transferase
Keywords: transferase
Deposited on 2004-07-28, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.226
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Family B DNA Polymerase
    Species: Thermococcus kodakarensis [TaxId:69014]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WN7 (0-End)
    Domains in SCOPe 2.07: d1wn7a1, d1wn7a2
  • Heterogens: NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wn7A (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyeegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfyergffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqitrdlkdykatgphvavakrlaargvkirpgtvisyivlkgsgrigdraipfdef
    dptkhkydaeyyienqvlpaverilrafgyrkedlryqktrqvglsawlkpkgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn7A (A:)
    mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
    tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
    lidkglvpmegdeelkmlafdietlyeegeefaegpilmisyadeegarvitwknvdlpy
    vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
    iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
    tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrsstgnlvewfllrk
    ayernelapnkpdekelarrrqsyeggyvkeperglwenivyldfrslypsiiithnvsp
    dtlnregckeydvapqvghrfckdfpgfipsllgdlleerqkikkkmkatidpierklld
    yrqraikilansyygyygyararwyckecaesvtawgreyitmtikeieekygfkviysd
    tdgffatipgadaetvkkkameflkyinaklpgaleleyegfyergffvtkkkyavidee
    gkittrgleivrrdwseiaketqarvleallkdgdvekavrivkevteklskyevppekl
    viheqiphvavakrlaatvisyivlraipfdefdptkhkydaeyyienqvlpaverilra
    fgyrkedlr