SCOPe 2.08: Structural Classification of Proteins

PDB entry 1wn2

View 1wn2 on RCSB PDB site
Description: Crystal structure of project ID PH1539 from Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: HYDROLASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-07-26, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.193
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Peptidyl-tRNA hydrolase
Species: Pyrococcus horikoshii [TaxId:70601]
Database cross-references and differences (RAF-indexed):
- Uniprot O74017 (Start-120)
Domains in SCOPe 2.08: d1wn2a_
Heterogens: NA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1wn2A (A:)
mikmfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvv
kveseeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkl
l

Sequence, based on observed residues (ATOM records): (download)

>1wn2A (A:)
mfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkve
seeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll