PDB entry 1wn2

View 1wn2 on RCSB PDB site
Description: Crystal structure of project ID PH1539 from Pyrococcus horikoshii OT3
Class: hydrolase
Keywords: HYDROLASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-07-26, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.193
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wn2a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wn2A (A:)
    mikmfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvv
    kveseeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkl
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn2A (A:)
    mfkykqvivaradlklskgklaaqvahgavtaafeaykkkrewfeawfregqkkvvvkve
    seeelfklkaeaeklglpnalirdaglteippgtvtvlavgpapeeivdkvtgnlkll