PDB entry 1wn1

View 1wn1 on RCSB PDB site
Description: Crystal Structure of Dipeptiase from Pyrococcus Horikoshii OT3
Deposited on 2004-07-26, released 2005-08-09
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.211
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: dipeptidase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wn1A (A:)
    mrlekfihllgergfdgalispgtnlyyltglrlhevgerlailavsaegdyrflapsly
    envvnnfpatfwhdgenpyaklreileelgiskgriliedtmradwligimklgkftfqp
    lsslikelrmikdkeevkmmehasriadkvfeeiltwdligmkerelalkiellirelsd
    giafepivasgenaanphhepgerkirkgdiiildygarwkgycsditrtiglgelderl
    vkiyevvkdaqesafkavregikakdvdsrareviskagygeyfihrtghglgldvheep
    yigpdgevilkngmtftiepgiyvpglggvrieddivvdegkgrrltkaereliil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wn1B (B:)
    mrlekfihllgergfdgalispgtnlyyltglrlhevgerlailavsaegdyrflapsly
    envvnnfpatfwhdgenpyaklreileelgiskgriliedtmradwligimklgkftfqp
    lsslikelrmikdkeevkmmehasriadkvfeeiltwdligmkerelalkiellirelsd
    giafepivasgenaanphhepgerkirkgdiiildygarwkgycsditrtiglgelderl
    vkiyevvkdaqesafkavregikakdvdsrareviskagygeyfihrtghglgldvheep
    yigpdgevilkngmtftiepgiyvpglggvrieddivvdegkgrrltkaereliil