PDB entry 1wmy

View 1wmy on RCSB PDB site
Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata
Class: sugar binding protein
Keywords: C-type lectin, N-acetylgalactosamine, Invertebrate, SUGAR BINDING PROTEIN
Deposited on 2004-07-22, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.14
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lectin CEL-I, N-acetyl-D-galactosamine-specific C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M462 (0-139)
  Domains in SCOPe 2.08: d1wmya_
• Chain 'B':
  Compound: lectin CEL-I, N-acetyl-D-galactosamine-specific C-type
  Species: Cucumaria echinata [TaxId:40245]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7M462 (0-139)
  Domains in SCOPe 2.08: d1wmyb_
• Heterogens: CA, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wmyA (A:)
  nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
  wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
  awndnsaaaqakymckltfe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wmyB (B:)
  nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
  wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
  awndnsaaaqakymckltfe