PDB entry 1wmy

View 1wmy on RCSB PDB site
Description: Crystal Structure of C-type Lectin CEL-I from Cucumaria echinata
Class: sugar binding protein
Keywords: C-type lectin, N-acetylgalactosamine, Invertebrate, SUGAR BINDING PROTEIN
Deposited on 2004-07-22, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.14
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin CEL-I, N-acetyl-D-galactosamine-specific C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wmya_
  • Chain 'B':
    Compound: lectin CEL-I, N-acetyl-D-galactosamine-specific C-type
    Species: Cucumaria echinata [TaxId:40245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wmyb_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmyA (A:)
    nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
    wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
    awndnsaaaqakymckltfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmyB (B:)
    nqcptdweaegdhcyrffntlttwenahhecvsyscstlnvrsdlvsvhsaaeqayvfny
    wrgidsqagqlwiglydkynegdfiwtdgskvgytkwaggqpdnwnnaedygqfrhtegg
    awndnsaaaqakymckltfe