PDB entry 1wmx

View 1wmx on RCSB PDB site
Description: Crystal Structure of Family 30 Carbohydrate Binding Module
Class: sugar binding protein
Keywords: CBM30, Carbohydrate Binding Module Family30, CelJ, SUGAR BINDING PROTEIN
Deposited on 2004-07-21, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.224
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG3291: FOG: PKD repeat
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmxa_
  • Chain 'B':
    Compound: COG3291: FOG: PKD repeat
    Species: Clostridium thermocellum [TaxId:203119]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmxb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmxA (A:)
    apegyrklldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvq
    sgwwislltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvt
    tvisnyvtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse
    dneksapaikvnqlgfipeaekyal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmxA (A:)
    lldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgwwisl
    ltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvisnyv
    tvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmxB (B:)
    apegyrklldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvq
    sgwwislltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvt
    tvisnyvtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitse
    dneksapaikvnqlgfipeaekyal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmxB (B:)
    gyrklldvqifkdspvvgwsgsgmgeletigdtlpvdttvtynglptlrlnvqttvqsgw
    wislltlrgwnthdlsqyvengylefdikgkeggedfvigfrdkvyervygleidvttvi
    snyvtvttdwqhvkiplrdlmkinngfdpssvtclvfskryadpftvwfsdikitsedne
    ksapaikvnqlgfip