PDB entry 1wmw

View 1wmw on RCSB PDB site
Description: Crystal structure of geranulgeranyl diphosphate synthase from Thermus thermophilus
Deposited on 2004-07-21, released 2005-07-21
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: geranylgeranyl diphosphate synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: geranylgeranyl diphosphate synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: geranylgeranyl diphosphate synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: geranylgeranyl diphosphate synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wmwA (A:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalverra
    

    Sequence, based on observed residues (ATOM records):
    >1wmwA (A:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalver
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wmwB (B:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalverra
    

    Sequence, based on observed residues (ATOM records):
    >1wmwB (B:)
    vpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgapleag
    leaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllaeg
    larglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytavap
    lrlgallagktppaayeegglrlgtafqivddvlnleggeragdlyegkrtlillrflee
    appeeraralallalpreakpeaevgwllerllasralawakaeakrlqaeglalleaaf
    qdlpgkealdhlrgllaal
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wmwC (C:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalverra
    

    Sequence, based on observed residues (ATOM records):
    >1wmwC (C:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalver
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1wmwD (D:)
    mvpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgaplea
    gleaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllae
    glarglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytava
    plrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlil
    lrfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaegla
    lleaafqdlpgkealdhlrgllaalverra
    

    Sequence, based on observed residues (ATOM records):
    >1wmwD (D:)
    vpapeairqalqerllarldhpdplyrdllqdyprrggkmlrglltvysalahgapleag
    leaatalelfqnwvlvhddiedgseerrgrpalhrlhpmplalnagdamhaemwgllaeg
    larglfppevllefhevvrrtaygqhldllwtlggtfdlrpedyfrmvahkaayytavap
    lrlgallagktppaayeegglrlgtafqivddvlnleggeaygkeragdlyegkrtlill
    rfleeappeeraralallalpreakpeaevgwllerllasralawakaeakrlqaeglal
    leaafqdlpgkealdhlrgllaal