PDB entry 1wmv

View 1wmv on RCSB PDB site
Description: Solution structure of the second WW domain of WWOX
Class: oxidoreductase, apoptosis
Keywords: WW domain, all-beta, OXIDOREDUCTASE, APOPTOSIS
Deposited on 2004-07-21, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WW domain containing oxidoreductase
    Species: Homo sapiens [TaxId:9606]
    Gene: WOX/FOR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZC7 (3-53)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1wmva1, d1wmva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmvA (A:)
    gsakrkrvagdlpygweqetdengqvffvdhinkrttyldprlaftvddnptkp