PDB entry 1wmu

View 1wmu on RCSB PDB site
Description: Crystal Structure of Hemoglobin D from the Aldabra Giant Tortoise, Geochelone gigantea, at 1.65 A resolution
Class: oxygen storage/transport
Keywords: HEMOGLOBIN D, REPTILIA, THE ALDABRA GIANT TORTOISE, Geochelone gigantea, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2004-07-21, released 2004-08-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.193
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin D alpha chain
    Species: Dipsochelys dussumieri [TaxId:167804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wmua_
  • Chain 'B':
    Compound: Hemoglobin A and D beta chain
    Species: Dipsochelys dussumieri [TaxId:167804]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wmub_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmuA (A:)
    mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk
    kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq
    vqvaydkflaavsavlaekyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmuB (B:)
    vhwtseekqyitslwakvnvgevggealarllivypwtqrffasfgnlssanailhnakv
    lahgqkvltsfgeavknldnikktfaqlselhceklhvdpenfkllgniliivlathfpk
    eftpasqaawtklvnavahalalgyh