PDB entry 1wms

View 1wms on RCSB PDB site
Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target
Class: protein transport
Keywords: GTPase, PROTEIN TRANSPORT
Deposited on 2004-07-16, released 2004-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.141
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-9A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmsa_
  • Chain 'B':
    Compound: Ras-related protein Rab-9A
    Species: Homo sapiens [TaxId:9606]
    Gene: Rab9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmsb_
  • Heterogens: GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmsA (A:)
    magksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqi
    wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
    ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlated
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmsA (A:)
    agksslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtag
    qerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
    idiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmsB (B:)
    magksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqi
    wdtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfv
    ilgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlated
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmsB (B:)
    sslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtagqer
    frslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadesfpfvilgnkidiserq
    vsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat