PDB entry 1wmr

View 1wmr on RCSB PDB site
Description: Crystal Structure of Isopullulanase from Aspergillus niger ATCC 9642
Class: hydrolase
Keywords: pullulan, glycoside hydrolase family 49, glycoprotein, HYDROLASE
Deposited on 2004-07-15, released 2005-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d1wmra1, d1wmra2, d1wmra3
  • Chain 'B':
    Compound: Isopullulanase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00105 (4-548)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d1wmrb1, d1wmrb2, d1wmrb3
  • Heterogens: NAG, NDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmrA (A:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmrB (B:)
    refmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvy
    laipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvr
    ydnqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspfensstkpqpgs
    pnsiapapgrvlglnttsastvvfnpgvyyftghdhmvlsssvtwvyfapgayvkgavef
    lstasevkasghgvlsgeqyvwyadpdegyqkasgannnglrmwrgtlgnssqtfvlngv
    tvsappfnsmdwsgnsldlitcrvddykqvgafygqtdglemypgtilqdvfyhtdddgl
    kmyysnvtarnivmwkesvapvvefgwtprntenvlfdnvdvihqayanagnnpgifgav
    nnylyapdglssnhstgnsnmtvrnitwsnfraegsssalfrinpiqnldnisiknvsie
    sfeplsintteswmpvwydlnngkqitvtdfsiegftvgnttitasnaasvgridgvdpa
    yagsvhyid