PDB entry 1wmq

View 1wmq on RCSB PDB site
Description: Structure of the HutP antitermination complex bound to a single stranded region of hut mRNA
Class: transcription/RNA
Keywords: HutP, protein-RNA complex, Antitermination, RNA binding, Transcription regulation, TRANSCRIPTION-RNA COMPLEX
Deposited on 2004-07-14, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wmqa_
  • Chain 'B':
    Compound: Hut operon positive regulatory protein
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10943 (0-146)
      • engineered (49)
    Domains in SCOPe 2.07: d1wmqb_
  • Chain 'C':
    Compound: 5'-r(p*up*up*up*ap*gp*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(p*up*up*up*ap*gp*up*u)-3'
  • Heterogens: MG, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmqA (A:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmqA (A:)
    tlhkerrigrlsvllllnstqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
    segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
    ygtigapikglehetfgvginhi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmqB (B:)
    tlhkerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskks
    gviqsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwi
    avslygtigapikglehetfgvginhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmqB (B:)
    tlhkerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviq
    segyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavsl
    ygtigapikglehetfgvginhi
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.