PDB entry 1wmo

View 1wmo on RCSB PDB site
Description: Crystal structure of topaquinone-containing amine oxidase activated by nickel ion
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, COPPER, Amine Oxidase, TOPAQUINONE, TPQ, Nickel, Biogenesis
Deposited on 2004-07-13, released 2005-08-02
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
    Domains in SCOP 1.75: d1wmoa1, d1wmoa2, d1wmoa3
  • Chain 'B':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
    Domains in SCOP 1.75: d1wmob1, d1wmob2, d1wmob3
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmoA (A:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmoA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmoB (B:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmoB (B:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan