PDB entry 1wmm

View 1wmm on RCSB PDB site
Description: Crystal structure of PH1033 from Pyrococcus horikoshii Ot3
Class: unknown function
Keywords: Pyrococcus horikoshii, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-07-12, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0310 protein PH1033
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wmma1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmmA (A:)
    mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
    vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
    smhffgkamrelpeedyklieklll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmmA (A:)
    mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
    vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm
    hffgkamrelpeedyklieklll