PDB entry 1wmk

View 1wmk on RCSB PDB site
Description: Human death-associated kinase DRP-1, mutant S308D d40
Deposited on 2004-07-11, released 2006-01-31
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.6 Å
R-factor: 0.277
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (308)
  • Chain 'C':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (308)
  • Chain 'E':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (308)
  • Chain 'F':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIK4
      • engineered (308)
  • Chain 'H':
    Compound: Death-associated protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wmkA (A:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkA (A:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wmkB (B:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkB (B:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrwkldfsivslc
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1wmkC (C:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkC (C:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1wmkD (D:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkD (D:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrwkldfsivslc
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >1wmkE (E:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkE (E:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrwkldfsivsl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >1wmkF (F:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkF (F:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrr
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >1wmkG (G:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkG (G:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrwkldfsivsl
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >1wmkH (H:)
    gmepfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsre
    eierevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsf
    ikqildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifg
    tpefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdee
    ffsqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkq
    yvrrrwkldfsivslcnhltr
    

    Sequence, based on observed residues (ATOM records):
    >1wmkH (H:)
    epfkqqkvedfydigeelgsgqfaivkkcrekstgleyaakfikkrqsrasrrgvsreei
    erevsilrqvlhhnvitlhdvyenrtdvvlilelvsggelfdflaqkeslseeeatsfik
    qildgvnylhtkkiahfdlkpenimlldknipiphiklidfglaheiedgvefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanitavsydfdeeff
    sqtselakdfirkllvketrkrltiqealrhpwitpvdnqqamvrresvvnlenfrkqyv
    rrrw