PDB entry 1wmi

View 1wmi on RCSB PDB site
Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
Class: hydrolase/hydrolase inhibitor
Keywords: toxin-antitoxin complex
Deposited on 2004-07-09, released 2005-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.228
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PHS013
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmia1
  • Chain 'B':
    Compound: hypothetical protein PHS014
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmib1
  • Chain 'C':
    Compound: hypothetical protein PHS013
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmic1
  • Chain 'D':
    Compound: hypothetical protein PHS014
    Species: Pyrococcus horikoshii OT3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmid1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmiA (A:)
    mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
    lgdyrviysvnwkdkvikilklkprgrayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmiA (A:)
    mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
    lgdyrviysvnwkdkvikilklkprgra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmiB (B:)
    mrmekvgdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidae
    elpeped
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmiB (B:)
    gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
    d
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wmiC (C:)
    mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
    lgdyrviysvnwkdkvikilklkprgrayk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmiC (C:)
    mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
    lgdyrviysvnwkdkvikilklkprgra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wmiD (D:)
    mrmekvgdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidae
    elpeped
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmiD (D:)
    gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
    d