PDB entry 1wmh

View 1wmh on RCSB PDB site
Description: Crystal structure of a PB1 domain complex of Protein kinase c iota and Par6 alpha
Class: Transferase/CELL CYCLE
Keywords: KINASE, PB1 DOMAIN, OPCA MOTIF, aPKC, Par6, cell polarity, Transferase/CELL CYCLE COMPLEX
Deposited on 2004-07-09, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein kinase C, iota type
    Species: Homo sapiens [TaxId:9606]
    Gene: PKCiota
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmha_
  • Chain 'B':
    Compound: Partitioning defective-6 homolog alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Par6alpha
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wmhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmhA (A:)
    gplgsqvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpct
    vssqleleeafrlyelnkdsellihvfpc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmhA (A:)
    qvrvkayyrgdimithfepsisfeglcnevrdmcsfdneqlftmkwideegdpctvssql
    eleeafrlyelnkdsellihvfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmhB (B:)
    gphmsivevkskfdaefrrfalprasvsgfqefsrllravhqipgldvllgytdahgdll
    pltnddslhralasgppplrllvqkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmhB (B:)
    sivevkskfdaefrrfalprasvsgfqefsrllravhqipgldvllgytdahgdllpltn
    ddslhralasgppplrllvqkr