PDB entry 1wmg

View 1wmg on RCSB PDB site
Description: Crystal structure of the UNC5H2 death domain
Class: apoptosis
Keywords: six helix bundle, death domain, apoptosis, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-07-09, released 2005-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3 (7-96)
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmga_
  • Chain 'B':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmgb_
  • Chain 'C':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3 (7-End)
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmgc_
  • Chain 'D':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3 (7-End)
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmgd_
  • Chain 'E':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3 (7-End)
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmge_
  • Chain 'F':
    Compound: netrin receptor Unc5h2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8K1S3
      • modified residue (42)
      • modified residue (83)
      • modified residue (88)
      • modified residue (92)
    Domains in SCOPe 2.07: d1wmgf_
  • Heterogens: SO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmgA (A:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgA (A:)
    yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
    qqddgdlnslasaleemgksemlvamatdg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wmgB (B:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgB (B:)
    afkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwearq
    dlnslasaleemgksemlvamat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wmgC (C:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgC (C:)
    yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
    qqdgdlnslasaleemgksemlvamatd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wmgD (D:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgD (D:)
    yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
    qgdlnslasaleemgksemlvamatd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wmgE (E:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgE (E:)
    yafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwear
    qqddgdlnslasaleemgksemlvamat
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wmgF (F:)
    gssgssgyafkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvi
    ldlwearqqddgdlnslasaleemgksemlvamatdgsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmgF (F:)
    afkiplsirqkicssldapnsrgndwrllaqklsmdrylnyfatkasptgvildlwearq
    qddgdlnslasaleemgksemlvamat