PDB entry 1wmf

View 1wmf on RCSB PDB site
Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (oxidized form, 1.73 angstrom)
Deposited on 2004-07-08, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.142
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmfA (A:)
    ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays
    agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai
    tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf
    wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy
    pngnqgwgrvtldkslnvayvnessslstsqkatysftatagkplkislvwsdapastta
    svtlvndldlvitapngtqyvgndftspyndnwdgrnnvenvfinapqsgtytievqayn
    vpvgpqtfslaivn