PDB entry 1wme

View 1wme on RCSB PDB site
Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.50 angstrom, 293 K)
Class: Hydrolase
Keywords: alpha-beta hydrolase fold, jelly-roll beta-barrel, Hydrolase
Deposited on 2004-07-08, released 2004-09-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.126
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Bacillus sp. [TaxId:109322]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wmea1, d1wmea2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmeA (A:)
    ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays
    agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai
    tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf
    wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy
    pngnqgwgrvtldkslnvayvnessslstsqkatysftatagkplkislvwsdapastta
    svtlvndldlvitapngtqyvgndftspyndnwdgrnnvenvfinapqsgtytievqayn
    vpvgpqtfslaivn