PDB entry 1wmd

View 1wmd on RCSB PDB site
Description: Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.30 angstrom, 100 K)
Class: Hydrolase
Keywords: alpha-beta hydrolase fold, jelly-roll beta-barrel, Hydrolase
Deposited on 2004-07-08, released 2004-09-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.134
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Bacillus sp. [TaxId:109322]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wmda1, d1wmda2
  • Heterogens: CA, SO4, DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmdA (A:)
    ndvargivkadvaqssyglygqgqivavadtgldtgrndssmheafrgkitalyalgrtn
    nandtnghgthvagsvlgngstnkgmapqanlvfqsimdsggglgglpsnlqtlfsqays
    agarihtnswgaavngayttdsrnvddyvrkndmtilfaagnegpnggtisapgtaknai
    tvgatenlrpsfgsyadninhvaqfssrgptkdgrikpdvmapgtfilsarsslapdssf
    wanhdskyaymggtsmatpivagnvaqlrehfvknrgitpkpsllkaaliagaadiglgy
    pngnqgwgrvtldkslnvayvnessslstsqkatysftatagkplkislvwsdapastta
    svtlvndldlvitapngtqyvgndftspyndnwdgrnnvenvfinapqsgtytievqayn
    vpvgpqtfslaivn