PDB entry 1wmb

View 1wmb on RCSB PDB site
Description: Crystal structure of NAD dependent D-3-hydroxybutylate dehydrogenase
Class: oxidoreductase
Keywords: NAD, NADH, short chain dehydrogenase, oxidoreductase
Deposited on 2004-07-06, released 2005-09-06
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmba1
  • Chain 'B':
    Compound: D(-)-3-hydroxybutyrate dehydrogenase
    Species: Pseudomonas fragi
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wmbb1
  • Heterogens: MG, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmbA (A:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wmbB (B:)
    mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
    gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
    gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
    naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
    daaaqitgttvsvdggwtar