PDB entry 1wma

View 1wma on RCSB PDB site
Description: Crystal structure of human CBR1 in complex with Hydroxy-PP
Class: Oxidoreductase
Keywords: Oxidoreductase
Deposited on 2004-07-06, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.109
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonyl reductase [NADPH] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wmaa1
  • Heterogens: SO4, AB3, NDP, PE5, P33, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wmaA (A:)
    ssgihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhq
    ldiddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdv
    ctellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkk
    gvhqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkat
    kspeegaetpvylallppdaegphgqfvsekrveqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wmaA (A:)
    sgihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhql
    diddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdvc
    tellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkkg
    vhqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkatk
    speegaetpvylallppdaegphgqfvsekrveqw