PDB entry 1wm9

View 1wm9 on RCSB PDB site
Description: Structure of GTP cyclohydrolase I from Thermus thermophilus HB8
Class: Hydrolase
Keywords: BETA BARREL, Hydrolase, pteridine, tetrahydrobiopterin, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-07-05, released 2005-07-19
The last revision prior to the SCOP 1.75 freeze date was dated 2005-10-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm9a1
  • Chain 'B':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm9b1
  • Chain 'C':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm9c1
  • Chain 'D':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm9d1
  • Chain 'E':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wm9e1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wm9A (A:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm9A (A:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wm9B (B:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm9B (B:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wm9C (C:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm9C (C:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wm9D (D:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm9D (D:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wm9E (E:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm9E (E:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr