PDB entry 1wm5

View 1wm5 on RCSB PDB site
Description: Crystal structure of the N-terminal TPR domain (1-203) of p67phox
Class: Hormone/Growth Factor
Keywords: Tetratricopeptide repeats, Hormone/Growth Factor COMPLEX
Deposited on 2004-07-03, released 2005-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19878 (5-207)
      • cloning artifact (1-4)
    Domains in SCOPe 2.07: d1wm5a2, d1wm5a3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wm5A (A:)
    gamgsmslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmte
    aekaftrsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglq
    fklfacevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepv
    vipvgklfrpnerqvaqlakkdylgkat
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm5A (A:)
    amgsmslveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmtea
    ekaftrsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqf
    klfacevlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvv
    ipvgklfrpnerqvaqlkdylgkat