PDB entry 1wm4

View 1wm4 on RCSB PDB site
Description: Solution structure of mouse coactosin, an actin filament binding protein
Class: protein binding
Keywords: ADF-H domain
Deposited on 2004-07-03, released 2004-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coactosin-like protein
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wm4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wm4A (A:)
    matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfa
    fvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkel
    eedfirselkkagganydaqse