PDB entry 1wm3

View 1wm3 on RCSB PDB site
Description: Crystal structure of human SUMO-2 protein
Class: protein transport
Keywords: ubiquitin fold, half-open barrel, two helices, PROTEIN TRANSPORT
Deposited on 2004-07-02, released 2004-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.119
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein SMT3B
    Species: Homo sapiens [TaxId:9606]
    Gene: SUMO-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wm3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wm3A (A:)
    hinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaql
    emededtidvfq