PDB entry 1wm1

View 1wm1 on RCSB PDB site
Description: Crystal Structure of Prolyl Aminopeptidase, Complex with Pro-TBODA
Class: hydrolase
Keywords: proline iminopeptidase, complex with inhibitor, hydrolase
Deposited on 2004-07-01, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wm1a_
  • Heterogens: PTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wm1A (A:)
    meqlrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfd
    perykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlal
    ayaqthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaa
    yrqrltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlg
    flesddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsyde
    pgilhqlmiatdrfagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wm1A (A:)
    lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
    ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
    qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
    rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
    sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
    lhqlmiatdrfag