PDB entry 1wlz

View 1wlz on RCSB PDB site
Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
Class: unknown function
Keywords: EF-hand like, UNKNOWN FUNCTION
Deposited on 2004-07-01, released 2005-08-23
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H5C4 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.01: d1wlza1
  • Chain 'B':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H5C4 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.01: d1wlzb_
  • Chain 'C':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wlzc_
  • Chain 'D':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wlzd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlzA (A:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzA (A:)
    hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
    drlwnempvnakgrlkypdflsrfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlzB (B:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzB (B:)
    hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
    drlwnempvnakgrlkypdflsrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wlzC (C:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzC (C:)
    atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
    lwnempvnakgrlkypdflsrfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wlzD (D:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzD (D:)
    atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
    lwnempvnakgrlkypdflsrfs