PDB entry 1wlz

View 1wlz on RCSB PDB site
Description: Crystal structure of DJBP fragment which was obtained by limited proteolysis
Class: unknown function
Keywords: EF-hand like
Deposited on 2004-07-01, released 2005-08-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H5C4 (4-End)
      • cloning artifact (2-3)
    Domains in SCOP 1.75: d1wlza1
  • Chain 'B':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H5C4 (4-End)
      • cloning artifact (2-3)
    Domains in SCOP 1.75: d1wlzb1
  • Chain 'C':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlzc1
  • Chain 'D':
    Compound: CAP-binding protein complex interacting protein 1 isoform a
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1wlzd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlzA (A:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzA (A:)
    hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
    drlwnempvnakgrlkypdflsrfs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlzB (B:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzB (B:)
    hmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqf
    drlwnempvnakgrlkypdflsrf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wlzC (C:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzC (C:)
    atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
    lwnempvnakgrlkypdflsrfs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wlzD (D:)
    gphmatadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltde
    qfdrlwnempvnakgrlkypdflsrfssetaatpmatgdsavaqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlzD (D:)
    atadrdilarlhkavtshyhaitqefenfdtmktntisreefraicnrrvqiltdeqfdr
    lwnempvnakgrlkypdflsrfs