PDB entry 1wly

View 1wly on RCSB PDB site
Description: Crystal Structure of 2-Haloacrylate Reductase
Deposited on 2004-06-30, released 2005-10-04
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.212
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-haloacrylate reductase
    Species: Burkholderia sp. WS [TaxId:306678]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wlyA (A:)
    mvmaavihkkggpdnfvweevkvgspgpgqvrlrntaigvnfldtyhragiphplvvgep
    pivvgfeaaavveevgpgvtdftvgervctclpplgaysqerlypaeklikvpkdldldd
    vhlaglmlkgmtaqyllhqthkvkpgdyvlihaaaggmghimvpwarhlgatvigtvste
    ekaetarklgchhtinystqdfaevvreitggkgvdvvydsigkdtlqksldclrprgmc
    aayghasgvadpirvvedlgvrgslfitrpalwhymsnrseidegskclfdavkagvlhs
    svaktfplreaaaahkymggrqtigsivllpqa
    

    Sequence, based on observed residues (ATOM records):
    >1wlyA (A:)
    vmaavihkkggpdnfvweevkvgspgpgqvrlrntaigvnfldtyhrappivvgfeaaav
    veevgpgvtdftvgervctclpplgaysqerlypaeklikvpkdldlddvhlaglmlkgm
    taqyllhqthkvkpgdyvlihaaaggmghimvpwarhlgatvigtvsteekaetarklgc
    hhtinystqdfaevvreitggkgvdvvydsigkdtlqksldclrprgmcaayghasgvad
    pirvvedlgvrgslfitrpalwhymsnrseidegskclfdavkagvlhssvaktfplrea
    aaahkymggrqtigsivllpqa